PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G055500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 293aa    MW: 33142.9 Da    PI: 8.669
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G055500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.5e-163380148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rg+WT+eEd +l +++k+ G g+W+  +++ g+ R++k+c++rw +yl
  Aqcoe1G055500.1.p 33 RGPWTPEEDRILSNYIKKEGEGRWRMLPKRAGLLRCGKSCRLRWMNYL 80
                       89******************************99************97 PP

2Myb_DNA-binding46.86.9e-1591131648
                        HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
  Aqcoe1G055500.1.p  91 PDEEDLILRLHRLLGNR-WALIAGRIP-GRTDNEIKNYWNTHL 131
                        89***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-222482IPR009057Homeodomain-like
PROSITE profilePS5129416.7742880IPR017930Myb domain
SuperFamilySSF466891.54E-2830127IPR009057Homeodomain-like
SMARTSM007171.1E-123282IPR001005SANT/Myb domain
PfamPF002498.6E-143380IPR001005SANT/Myb domain
CDDcd001671.26E-103580No hitNo description
PROSITE profilePS5129424.34981135IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.4E-2483136IPR009057Homeodomain-like
SMARTSM007172.4E-1385133IPR001005SANT/Myb domain
CDDcd001673.74E-1191131No hitNo description
PfamPF002498.3E-1491131IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MSRKGKEMQP TKASSIASPS KTTPCCSKVG LKRGPWTPEE DRILSNYIKK EGEGRWRMLP  60
KRAGLLRCGK SCRLRWMNYL RPSVKRGQIA PDEEDLILRL HRLLGNRWAL IAGRIPGRTD  120
NEIKNYWNTH LSKKLISQGI DPRTHKPLNP NIPNSSINLQ PPAAPKQKYN LNTNPNSSCN  180
DYLEATTNLD QDHNWLNSNE RDDMGLCSDE VFSSFLNSLI NDDAVANQQQ QQQQHQNQPN  240
VNPIHENVAS SGNGTFGYDA TWDNATLICS PSDFSHENEQ RRFVDHQANQ DS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-26311355108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2539550.0AC253955.1 Aquilegia coerulea clone COL08-M12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010276363.11e-105PREDICTED: transcription repressor MYB5-like
SwissprotQ388501e-90MYB5_ARATH; Transcription repressor MYB5
TrEMBLH9XUF91e-107H9XUF9_9MAGN; R2R3-MYB transcription factor MYB9
STRINGVIT_06s0004g00570.t011e-101(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.12e-84myb domain protein 5